PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00049459-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family bZIP
Protein Properties Length: 475aa    MW: 51328.9 Da    PI: 7.4245
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00049459-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.24.8e-10279337563
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                       kr++r   NR +A rs +RK  +i eLe++v++L++e ++L  +l +l+     l++e+
  PSME_00049459-RA 279 KRAKRILANRQSAVRSKERKMRYISELERRVQTLQTEATTLSAQLTMLQRDTTGLTTEN 337
                       9*********************************************9998877777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.9E-16275339IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.001277340IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-8279327No hitNo description
SuperFamilySSF579595.42E-11279331No hitNo description
PfamPF001701.0E-8279336IPR004827Basic-leucine zipper domain
CDDcd147032.18E-23280329No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MEGLGDGYEA FVGRLKMDMA TANGPKNTTG NSLSNPSQSQ QVQQARYVGY PSSTNAFTVT  60
REAKPALSDS SGNSVAMDVS MQEPVSSSGA VGVAEPSGNR GPSQNFSTDV SRMPDVPPRR  120
GGHRRAQSEI AFRLPDDIMF DGDLGFSGFD MPTVSDDATE AEDLISMYMD MEKLTSFGEP  180
LNAAAGEGSK LPSGADTNRA PHHSRSLSVD AVFSGLEGNL EGTRGNLGSA GPSRPRHRHS  240
NSMDSSSSLQ INQLSSESLE TKKAMAAKKL QELALIDPKR AKRILANRQS AVRSKERKMR  300
YISELERRVQ TLQTEATTLS AQLTMLQRDT TGLTTENNEL KLRLQAMEQQ AQLRDALNEA  360
LRDKVQRLKI ATGQIAPNNT NAFNMSAPAQ QLPLNRSFFP PTQHSHRLNQ QFQSFQHSTS  420
ALNNQPLMGQ SQVHQNFPHY GPAGQLQGLV GSQGGSAVES EVSSSSINLP SSSSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6766230.0EF676623.1 Picea sitchensis clone WS02744_N16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001755982.11e-106predicted protein
RefseqXP_001755887.11e-106predicted protein
SwissprotQ040883e-84POF21_ARATH; Probable transcription factor PosF21
TrEMBLB8LLI30.0B8LLI3_PICSI; Putative uncharacterized protein
STRINGPP1S20_116V6.11e-133(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31370.57e-80bZIP family protein